SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012426 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012426
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 5.4e-32
Family SH2 domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 154-215
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-23
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012426   Gene: ENSGGOG00000012739   Transcript: ENSGGOT00000012786
Sequence length 217
Comment pep:novel chromosome:gorGor3.1:5:60626186:60652844:1 gene:ENSGGOG00000012739 transcript:ENSGGOT00000012786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
Download sequence
Identical sequences A0A2J8J714 A0A2J8R0M9 G3RAF5 Q13588
ENSP00000284154 HR2926 9606.ENSP00000284154 ENSGGOP00000012426 ENSP00000284154 ENSP00000284154 ENSGGOP00000012426 NP_006604.1.87134 NP_006604.1.92137 XP_004042191.1.27298 XP_016879518.1.92137 gi|5729856|ref|NP_006604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]