SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012454 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012454
Domain Number 1 Region: 952-1133
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-18
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 2 Region: 644-714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000695
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 334-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000171
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 701-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000425
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 856-934
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000085
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 259-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000101
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 777-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 8 Region: 739-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000213
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 491-610
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000581
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 10 Region: 379-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000069
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 607-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000697
Family EGF-type module 0.022
Further Details:      
 
Domain Number 12 Region: 1258-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 220-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 299-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family EGF-type module 0.024
Further Details:      
 
Domain Number 15 Region: 817-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 421-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000037
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012454
Domain Number - Region: 456-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0124
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012454   Gene: ENSGGOG00000012750   Transcript: ENSGGOT00000012815
Sequence length 1361
Comment pep:novel chromosome:gorGor3.1:2b:130436664:130557930:1 gene:ENSGGOG00000012750 transcript:ENSGGOT00000012815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRPLSVCIFLLGLEFAQLFVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRR
AGDVYYREATDPAMLRRATEDVRRYFPELLDFNATWVFVATWYRVTFFGGSSSSPVNTFQ
TVLITDGKLSFTIFNYESIVWTTGTHASSGGNATGLGGIAAQAGFNAGDGQRYFSIPGSR
TADMAEVETTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGN
PSYTCSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPTGFGGPTCETAQSP
CDTKECQHGGQCQVKNGSAVCVCQAGYTGAACETDVDDCSPDPCLNGGSCVDLVGNYTCL
CAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDC
ECRNGGRCLGANTTLCQCPPGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCH
TDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNG
GTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGR
HCEIAPSPCFRSPCVNGGTCEDRGTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFN
GTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECQSQPCLHGGSCQDRV
AGYLCLCSTGYEGAHCELERDKCRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEVDA
CDSSPCQHGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCT
CKVGYTGKDCAKELFPPTALKMERVEESGVSISWNPPDGPAARQMLDGYAVTYVSSDGSY
RRTDFVDRTRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFE
VTNVTASTISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGRR
YTIQLTTLSGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSAHVVWDAPTPGSL
LEAYVINVTTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVIAVQSTELGPQHSEPAHL
YIITSPRDGADRRWHQGGHHPRVLRNRPPPARLPELRLLNDHSAPETPSQPPRFSELVDG
RGRVSARFGGSPSKAATVRSQPTASAQLENMEEAPKQVSLALQLPEHGNKDIGNVPGNCS
ENPCQNGGTCVPGADAHSCDCGPGFKGRRCELACIKVSRPCTRLFSETKSFPVWEGGVCH
HVYKRVYRVHQDICFKESCESTSLKKTPNRKQSKSQTLEKS
Download sequence
Identical sequences ENSGGOP00000012454 ENSGGOP00000012454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]