SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012465 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012465
Domain Number 1 Region: 37-253
Classification Level Classification E-value
Superfamily L domain-like 1.44e-31
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 251-345
Classification Level Classification E-value
Superfamily Immunoglobulin 7.14e-17
Family I set domains 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012465
Domain Number - Region: 367-433
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00016
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012465   Gene: ENSGGOG00000012781   Transcript: ENSGGOT00000012826
Sequence length 550
Comment pep:novel chromosome:gorGor3.1:10:97267843:97272143:-1 gene:ENSGGOG00000012781 transcript:ENSGGOT00000012826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFHYFLLVLVFLDTHAAQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQV
RIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPW
TAFRATPLLRVLDLKRNKIDALPELALQFLFSLTYLDLSSNRLTVVSKSVFLNWPAYQKC
RQPDCGAEILSSLVVALHDNPWVCDCRLRGLVQFVKSITLPVILVNSYLICQGPLSKAGQ
LFHETELSACMKPQISTPSANITIRVGQNVILRCLAQASPSPSIAWTYPLSMWREFDVLT
SSTGEDTALSELAIPAAHLVDSGNYTCMASNSIGKSTLVISLHVQPAQALHAPDSLSIPS
EGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAV
DDLLPGTKYEACLSLEGQPPHQGQCVAFVTGRDAGGLEARERLLHVTVVLCVVLLAVPVG
AYAWAAQGPCSCSKWVLRCCLHRRKAPSCPPAAPQSRDDSFREHPAVCDDGEGHIDTEGD
KEKEGTEDNS
Download sequence
Identical sequences G3RAJ2
ENSGGOP00000012465 ENSGGOP00000012465 XP_004049746.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]