SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012490 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012490
Domain Number 1 Region: 345-423
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.73e-26
Family Intermediate filament protein, coiled coil region 0.00079
Further Details:      
 
Domain Number 2 Region: 116-149
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000476
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012490
Domain Number - Region: 227-341
Classification Level Classification E-value
Superfamily Prefoldin 0.000173
Family Prefoldin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012490   Gene: ENSGGOG00000012807   Transcript: ENSGGOT00000012852
Sequence length 473
Comment pep:novel chromosome:gorGor3.1:5:42459577:42462624:1 gene:ENSGGOG00000012807 transcript:ENSGGOT00000012852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFSGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANTDLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAEAWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
Download sequence
Identical sequences ENSGGOP00000012490 ENSGGOP00000012490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]