SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012497 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012497
Domain Number 1 Region: 61-262
Classification Level Classification E-value
Superfamily L domain-like 7.18e-32
Family Ngr ectodomain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012497   Gene: ENSGGOG00000012816   Transcript: ENSGGOT00000012859
Sequence length 268
Comment pep:novel chromosome:gorGor3.1:12:89886614:89901213:-1 gene:ENSGGOG00000012816 transcript:ENSGGOT00000012859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIEIATVMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNED
FPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDL
TSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFK
DMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDI
RLDGNPINLSKTPQAYMCLPRLPVGSLV
Download sequence
Identical sequences ENSGGOP00000012497 ENSGGOP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]