SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012516 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012516
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily HAD-like 1.22e-44
Family beta-Phosphoglucomutase-like 0.00000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012516   Gene: ENSGGOG00000012837   Transcript: ENSGGOT00000012878
Sequence length 248
Comment pep:novel chromosome:gorGor3.1:20:26262454:26276105:-1 gene:ENSGGOG00000012837 transcript:ENSGGOT00000012878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKEC
FHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTE
LRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQ
PGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSI
DCKVSMST
Download sequence
Identical sequences G3RAP1 Q8TBE9
ENSP00000302441 ENSGGOP00000012516 ENSP00000302441 ENSGGOP00000012516 gi|23308749|ref|NP_689880.1| ENSP00000302441 NP_689880.1.87134 NP_689880.1.92137 XP_004061981.1.27298 399982 9606.ENSP00000302441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]