SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012602 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012602
Domain Number 1 Region: 667-735
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.1e-20
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1579-1638
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1136-1263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 4 Region: 1413-1469,1497-1505
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.00034
Further Details:      
 
Domain Number 5 Region: 853-970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000549
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 928-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 1014-1139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 1225-1345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000154
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 551-616
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000183
Family TB module/8-cys domain 0.0033
Further Details:      
 
Domain Number 10 Region: 616-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000003
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 11 Region: 1734-1818
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 12 Region: 1477-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1339-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1522-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012602
Domain Number - Region: 190-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 400-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012602   Gene: ENSGGOG00000012899   Transcript: ENSGGOT00000012965
Sequence length 1821
Comment pep:novel chromosome:gorGor3.1:14:55761656:55878303:-1 gene:ENSGGOG00000012899 transcript:ENSGGOT00000012965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRTKARSPGRALRNPWRGFLPLTLALFVGSGHAQRDPVGRYEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQEAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQ
TRRSTPLGQQQPAPRARAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWA
EHSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLSDLSQTHPSQQHVGLSRTVRL
HPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIIFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHH
PPEASVQIHQVAQVRGGVEEALVENSVETRPLPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCSPRPASPV
IENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSR
CVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAF
REICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTW
LEAGTIPDKGDSQAGQVTTSVTHAPAWITGNATTPPMPEQGIPELQEEQVTPSTDVLVTL
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYRLHPSQAYCTDDNECLRDPCKGKG
RCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGY
IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVC
AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACEN
GYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECE
DPQSSCLGGECKNTVGSYQCLCPQGFQLANGTMCEDVNECMGEEHCAPHGECLNSHGSFF
CLCAPGFVSAEGGTSCQDVDECATTDPCLGGHCVNTEGSFNCLCETGFQPSPESGECVDI
DECEDYGDPVCGAWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCD
NTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYD
AQEGHCRPRGAGGQSISEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ
GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG
RCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLD
LSQQRCMNSTSSTEDLPDHDIHMDVCWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQ
CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGIL
NGCENGRCVRVREGYTCDCFEGFQLDAAHMACIDVNECDDLNGPAVLCVHGYCENTEGSY
RCHCSPGYVAEAGPPHCTAKE
Download sequence
Identical sequences ENSGGOP00000025837 ENSGGOP00000012602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]