SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012685 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012685
Domain Number 1 Region: 3983-4201
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-77
Family Fibrinogen C-terminal domain-like 0.00000268
Further Details:      
 
Domain Number 2 Region: 1030-1198
Classification Level Classification E-value
Superfamily Fibronectin type III 5.03e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 3720-3808
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-18
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 2599-2682
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 1446-1616
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-17
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 6 Region: 1958-2041
Classification Level Classification E-value
Superfamily Fibronectin type III 2.99e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 2274-2357
Classification Level Classification E-value
Superfamily Fibronectin type III 8.46e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 3410-3500
Classification Level Classification E-value
Superfamily Fibronectin type III 9.02e-17
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 2809-2898
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 10 Region: 2486-2576
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 11 Region: 2700-2790
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 12 Region: 2166-2248
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 13 Region: 2067-2149
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 14 Region: 3525-3607
Classification Level Classification E-value
Superfamily Fibronectin type III 3.78e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 15 Region: 3136-3220
Classification Level Classification E-value
Superfamily Fibronectin type III 3.82e-16
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 16 Region: 2920-3006
Classification Level Classification E-value
Superfamily Fibronectin type III 4.31e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 17 Region: 3226-3314
Classification Level Classification E-value
Superfamily Fibronectin type III 4.43e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 18 Region: 2383-2465
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 19 Region: 3808-3969
Classification Level Classification E-value
Superfamily Fibronectin type III 6.21e-16
Family Fibronectin type III 0.00000337
Further Details:      
 
Domain Number 20 Region: 3623-3716
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000148
Family Fibronectin type III 0.00000201
Further Details:      
 
Domain Number 21 Region: 1233-1315
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000182
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 22 Region: 806-894
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000209
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 23 Region: 1641-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000365
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 24 Region: 3316-3401
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000378
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 25 Region: 1341-1426
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000476
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 26 Region: 1742-1830
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000151
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 27 Region: 3031-3114
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000153
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 28 Region: 1853-1935
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000238
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 29 Region: 725-806
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000481
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 30 Region: 927-1007
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000172
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012685
Domain Number - Region: 592-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000804
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 562-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 221-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 252-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 283-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 345-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00435
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 159-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00519
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 500-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00519
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 438-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00904
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 407-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0127
Family Integrin beta EGF-like domains 0.059
Further Details:      
 
Domain Number - Region: 376-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 469-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 313-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0385
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 190-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 531-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0553
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 691-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.072
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012685   Gene: ENSGGOG00000012983   Transcript: ENSGGOT00000013051
Sequence length 4208
Comment pep:novel chromosome:gorGor3.1:6:32905952:32987836:-1 gene:ENSGGOG00000012983 transcript:ENSGGOT00000013051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPGTE
PPVPASEVQALRVRLEILEELVKGLKEQCTGGCCSASAQAGTGQTDVRTLCSLHGVFDLS
RCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPS
CGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTG
DDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCEDGRCVCDPGY
TGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDT
GYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVCVC
NAGYSGEDCGVRSCPGDCRGRGRCESGRCVCWPGYTGRDCGTRACPGDCRGRGRCVDGRC
VCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDG
RCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVGEDCSIRTCPSNCHGRGRCE
EGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGC
GPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTI
EGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGLAP
GQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVV
SYVSAGNQRVRLEVPPEADGTLLTDLMPGVEYVVTVTAERGRAVSYPASVRANTGSSPSG
LLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAHFQ
LRMRVPEGPGAHEEVLPGDVRQAVVPPPPPGTLYELSLHGVPPGGKPSDPIIYQGIMDKD
EEKPGKSSGPPRLGELTVTDRTSDSLLLRWTVPEGEFDSFMIQYKDRDGQPQVVPVEGPQ
RSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPRLGNLWVTDPTP
DSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIAN
KKRYGPLTADGTTAPERKEEPPRPEFLEQPLLGELTVTGVTPDSLRLSWTVAQGPFDSFM
VQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQED
VDETPSPTELGTEAPESPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGR
PRAVRVGGKESEVTVGGLEPGHKYKMHLYGLHEGQRVGPVSAVGVTAPQQEETPPATESP
LEPRLGELTVTDVTPNSVGLSWTVPEGQFDSFMVQYKDKDGQPQVVPVAADQREVTVYNL
EPERKYKMNMYGLHDGQRMGPLSVVIMTAPLPPAPATEASKPPLEPRLGELTVTDITPDS
VGLSWTVPEGEFDSFVVQYKDRDRQPQVVPVAADQREVTIPDLEPSRKYKFLLFGIQDGK
RRSPVSVEAKTVARGDASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKD
GPQVVPVEGHERSVTVTPLDASRKYRFLLYGLLGKKRHGPLTADGTTEAQSAMDDTGTKR
PPKPRLGEELQVTTVTQNSVGLSWTVPEGQFDSFVVQYKDRDGQPQVVPVEGSLREVSVP
GLDPAHRYKLLLYGLHRGKRVGPISAVAITASREETETETTAPTPPAPEPHLGELTVEEA
TPHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRTGGDRNDITLSGLESDHRYLVTLYGF
RDGKHVGPVHVEALTVPEEEEPSEPPTATPEPPIKPRLGELTVTDATPDSLSLSWTVPEG
RFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVVGV
TAAEEETPSPTEPSMEAPEPAEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDR
DGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSAVGVTAPEEESPDAPL
AKLRLGEMTVRDITSDSLSLSWTVPEGQFDHFLVQYKNGDGQPKAVRVPGHEDGVTISGL
EPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLGELTVT
DATPDSLSLSWMVPEGQFDHFLVQYKNGDGQPKATRVPGHEDRVTISGLEPDHKYKMNLY
GFHGGQRVGPVSAIGVTGEWMMGAPGWEPFPFSXXXXEEPLLGELTVTGSSPDSLSLSWT
VPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVS
TVGVTAPQEDVDETPSPTEPGTEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSF
TVQYKDRDGRPQAVRVGGQESEVTVRGLEPGRKYKMHLYGLHEGQRLGPVSAVGVTEDEA
ETTQAVPTMTPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAV
RVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSTEAPE
PPEEPLLGELTVTGSSPDSLSLSWTVPQGHFESFTVQYKDRDGRPQVVRVRGEESEVTVG
GLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPEDEAETTQAVPTMTPEPPNKPRLGELTV
TDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVLGHEDGVTISGLEPDHKYKMNL
YGFHGGQRVGPISVTGVTAAEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSLSLSW
TVPQGRFDSFTVQYKDRDGRPQAVHVRGEESEVTVGGLEPGRKYKMHLYGLHEGQRVGPV
STVGITGEWGDRPSSPGLPPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLV
QYRDVQGQPQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTCESHSP
CTSLSFPAPDTKPSPRLGELTVTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPV
AANQREVTVQGLEPRRKYRFLLYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEET
SSSLRLSWTVAQGPFDSFVVQYRDTDGQPRAVPVAADQRAVTVEDLEPGKKYKFLLYGLL
GGKRLGPVSALGMTAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNG
QPQALLVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSEPSTEAPEPPEEPLLGEL
TVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGRKYKM
HLYGLHEGQRVGPVSTVGVTAPEEDTPAPELAPEAPEPPEEPRLGVLTVTDTTPDSMRLS
WSVAQGPFDSFVVQYEDTNGQPQALLVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGP
LSAEGTTGPAPAGQTSAESRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPS
TLEPHPRPLLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTARTLSPV
LESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQLADGGEPQSVQVDGQARTQKLQGL
IPGARYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTY
DVQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPATITFTTGLEA
PRDLEAKEVTPRTALLTWTEPQVRPTGYLLSFDTPGGQTQEILLPGGITSHLLGLFPSTP
YNARLQAMWGQSLLPPVSTSFTTGGLQIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPL
NVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDY
SMRVDLRARDEAVFAQYDSFRVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPN
NLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRN
FRSPAGGG
Download sequence
Identical sequences ENSGGOP00000012685 ENSGGOP00000012685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]