SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012737 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012737
Domain Number 1 Region: 30-461
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.62e-83
Family Integrin alpha N-terminal domain 0.00000119
Further Details:      
 
Domain Number 2 Region: 461-620
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-30
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 624-762
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-28
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 768-983
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000523
Family Integrin domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012737   Gene: ENSGGOG00000013044   Transcript: ENSGGOT00000013104
Sequence length 1035
Comment pep:novel chromosome:gorGor3.1:3:38478667:38852593:1 gene:ENSGGOG00000013044 transcript:ENSGGOT00000013104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPAAPKGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGMSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHPSTTDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLCGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
QITEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLRGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVVDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
Download sequence
Identical sequences ENSGGOP00000012737 ENSGGOP00000012737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]