SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012782 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012782
Domain Number 1 Region: 23-139,329-637
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.09e-73
Family Integrin alpha N-terminal domain 0.0000444
Further Details:      
 
Domain Number 2 Region: 159-353
Classification Level Classification E-value
Superfamily vWA-like 3.06e-51
Family Integrin A (or I) domain 0.000000892
Further Details:      
 
Domain Number 3 Region: 637-783
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-30
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 784-797,826-945
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-22
Family Integrin domains 0.0041
Further Details:      
 
Domain Number 5 Region: 966-1146
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000136
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012782   Gene: ENSGGOG00000013093   Transcript: ENSGGOT00000013151
Sequence length 1189
Comment pep:novel chromosome:gorGor3.1:15:47643002:47779605:-1 gene:ENSGGOG00000013093 transcript:ENSGGOT00000013151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGA
PLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQALRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPVFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKKVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELSAGSDSNERDSTKEDNVAPLRFHLKYEADILFA
RSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLL
KLRDFLTDQVANTSCNIWGNSTEYRPTPMEEDLRRAPQLNHSNSDVVSINCNIRLVPNQE
INFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQ
VPIWIIVGSTLGGLLLLALLVLALWKLGFFKSARRRREPGLDPTPKVLE
Download sequence
Identical sequences ENSGGOP00000012782 ENSGGOP00000012782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]