SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012883 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012883
Domain Number 1 Region: 35-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000118
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 2 Region: 173-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012883   Gene: ENSGGOG00000013206   Transcript: ENSGGOT00000013254
Sequence length 272
Comment pep:novel chromosome:gorGor3.1:1:22528268:22541040:1 gene:ENSGGOG00000013206 transcript:ENSGGOT00000013254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLLLRSHAASRRFYFVAP
DTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPP
GAPRPLGSPLCGLTIPVPVASSGPFLGLRLVTRGRKPRVDFVGEVTSFRLGPCGAYFRCQ
NGRCIPSSLVCDPWGMDNRGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRPPTPSPAL
GSAGSLRIAAERSSPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences G3RBM2
ENSGGOP00000012883 XP_004024899.1.27298 ENSGGOP00000012883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]