SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012909 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000012909
Domain Number - Region: 54-90
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012909   Gene: ENSGGOG00000013237   Transcript: ENSGGOT00000013281
Sequence length 99
Comment pep:novel chromosome:gorGor3.1:2a:32611539:32629151:-1 gene:ENSGGOG00000013237 transcript:ENSGGOT00000013281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
Download sequence
Identical sequences A0A091E3C4 A0A096NAA2 A0A250Y8T2 A0A2I2YG65 A0A2I3GIG7 A0A2K5I343 A0A2K5LFS2 A0A2K5QQQ1 A0A2K5VRJ2 A0A2K5YRN3 A0A2K6D6Y8 A0A2K6FTU1 A0A2K6MEC1 A0A2K6RH52 A0A2K6UQ96 F2Z5F7 F7GJI8 F7IR99 G1PS50 G1TEM5 H2P6J7 H2QHQ3 Q2NKU6 Q9C005 S7NSS7
ENSP00000295066 ENSP00000345837 ENSOCUP00000015357 ENSVPAP00000011627 NP_001071384.1.59421 NP_001071384.1.76553 NP_001231854.1.46622 NP_001248022.1.72884 NP_001308138.1.87134 NP_001308138.1.92137 NP_115963.1.87134 NP_115963.1.92137 XP_001164263.1.37143 XP_001164291.1.37143 XP_002709976.1.1745 XP_002757925.1.60252 XP_002757926.1.60252 XP_003262756.1.23891 XP_003827214.1.60992 XP_003827215.1.60992 XP_003944025.1.74449 XP_003944026.1.74449 XP_004006092.1.66739 XP_004029118.1.27298 XP_004029119.1.27298 XP_004268240.1.21590 XP_004268241.1.21590 XP_004317684.1.83887 XP_004317685.1.83887 XP_004480900.1.11602 XP_004582773.1.84141 XP_004627648.1.9945 XP_005390892.1.28644 XP_005576232.1.63531 XP_005576233.1.63531 XP_005576234.1.63531 XP_005655306.1.46622 XP_005686450.1.57651 XP_005686451.1.57651 XP_005886113.1.60319 XP_005886114.1.60319 XP_005893073.1.15283 XP_005893074.1.15283 XP_005963897.1.78601 XP_005963898.1.78601 XP_006080638.1.26621 XP_006080639.1.26621 XP_006094410.1.53796 XP_006094411.1.53796 XP_006168872.1.99106 XP_006168873.1.99106 XP_006168874.1.99106 XP_006183231.1.101512 XP_006197314.1.17985 XP_006767481.1.95426 XP_006767482.1.95426 XP_007102524.1.24612 XP_007102525.1.24612 XP_007102526.1.24612 XP_007191442.1.59432 XP_007191443.1.59432 XP_007451022.1.90284 XP_007451023.1.90284 XP_007936992.1.48129 XP_007936993.1.48129 XP_007969216.1.81039 XP_008160483.1.99482 XP_008581579.1.73410 XP_008581580.1.73410 XP_010370891.1.97406 XP_010643610.1.5607 XP_010808171.1.76553 XP_010828114.1.44457 XP_010828116.1.44457 XP_010965913.1.22495 XP_010986074.1.51371 XP_010986075.1.51371 XP_011736117.1.29376 XP_011791395.1.43180 XP_011791396.1.43180 XP_011839640.1.47321 XP_011839641.1.47321 XP_011899498.1.92194 XP_012018537.1.54773 XP_012018538.1.54773 XP_012027370.1.54773 XP_012507882.1.63892 XP_012507883.1.63892 XP_012643828.1.48125 XP_012643829.1.48125 XP_012643830.1.48125 XP_014316056.1.53796 XP_014388682.1.60319 XP_014967516.1.72884 XP_015098239.1.17985 XP_015098243.1.17985 XP_015289313.1.63531 XP_015421828.1.95426 XP_017390329.1.71028 XP_017390330.1.71028 XP_017518115.1.32401 XP_017518116.1.32401 XP_017726139.1.44346 XP_017726140.1.44346 XP_019509350.1.44202 XP_019509351.1.44202 XP_019597158.1.88060 XP_019597167.1.88060 XP_019597177.1.88060 XP_019825527.1.53367 XP_019825528.1.53367 XP_020037458.1.5219 XP_020037459.1.5219 XP_020037460.1.5219 XP_020037461.1.5219 XP_020037462.1.5219 XP_020037463.1.5219 XP_020763628.1.74333 XP_020763629.1.74333 XP_020763630.1.74333 ENSP00000295066 ENSP00000345837 ENSMMUP00000019013 ENSNLEP00000018913 ENSPPYP00000013973 ENSGGOP00000012909 ENSPTRP00000020279 ENSGGOP00000012909 9544.ENSMMUP00000019013 9598.ENSPTRP00000020279 9600.ENSPPYP00000013973 9606.ENSP00000295066 9823.ENSSSCP00000009082 9986.ENSOCUP00000015357 ENSCJAP00000005899 ENSSSCP00000009082 ENSVPAP00000011627 ENSBTAP00000012183 ENSCJAP00000005899 gi|14211889|ref|NP_115963.1| ENSNLEP00000018913 ENSPPYP00000013973 HR56 ENSMLUP00000013982 ENSSSCP00000009082 ENSPTRP00000020279 ENSMMUP00000019013 ENSBTAP00000012183 ENSPANP00000009606 ENSMLUP00000013982 ENSOCUP00000015357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]