SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012930 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012930
Domain Number 1 Region: 421-565
Classification Level Classification E-value
Superfamily CBS-domain pair 4.53e-16
Family CBS-domain pair 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012930
Domain Number - Region: 659-708
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000636
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012930   Gene: ENSGGOG00000013254   Transcript: ENSGGOT00000013303
Sequence length 864
Comment pep:novel chromosome:gorGor3.1:10:116517166:116663595:1 gene:ENSGGOG00000013254 transcript:ENSGGOT00000013303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGQAAAALPTWKMAARRSLSARGRGILQAAAGRLLQLLLLSCCCGAGGCAAVGENEET
VIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGE
RGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPLRKMEKSKSYYLC
TSLSTPALGAGGSGSTGGAVGGKGGSGVAGLPPPPWAETTWIYHDGEDTKMIVGEEKKFL
LPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKNYAKRIEPVRRQG
NYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTIGIVIFGEIVPQAICSRHGLAVG
ANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPYNDLVKEEL
NIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIV
DLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVN
NEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQT
DSEMKVKISPQLLLAMHLVFISIEVEAFSPSQMSEKILLRLLKHPNVIQELKYDEKNKKA
PEYYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALTASPVPLSLSRTF
VVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDAVTPTLGSSNNQLNSSLLQVYI
PDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLTELHDGLPDETA
NLLNEQNCVTHSKANHSLHNEGAI
Download sequence
Identical sequences ENSGGOP00000012930 ENSGGOP00000012930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]