SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013103 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013103
Domain Number 1 Region: 529-591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.57e-19
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number 2 Region: 472-531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 228-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 289-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000834
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 410-465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 169-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000123
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 108-165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000341
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 46-113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000445
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013103
Domain Number - Region: 352-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000445
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013103   Gene: ENSGGOG00000002429   Transcript: ENSGGOT00000013481
Sequence length 592
Comment pep:novel chromosome:gorGor3.1:1:176694819:176735021:1 gene:ENSGGOG00000002429 transcript:ENSGGOT00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKADLKQHHHHWSIFSYILRLPSMLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEE
DYNPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHS
ESSGLIHLEGDTVQIICNTGYRLQNNEKNISCVERGWSTPPICSFTKEECHVPILEANVD
AQPKKESYKVGDVLKFSCRKNLIRVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNG
EVKEIRKEEYGHNEVVEYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEY
GYVQLSVPPYQHGVSVEVNCRNEYAVIGNNMITCVNGIWTELPMCVATHQLKRCKIAGVN
IKTLLKLSGKEFNHNSRIRYRCSDIFRYRHSVCINGKWNPELDCTEKREQFCPPPPQIPN
AQNMTTTVNYQDGEKVAVLCKENYLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINN
GDTTSFPLSVYPPGSTVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKN
NIQLKWRNDGKLYAKTGDAVEFQCKFPHKAMISSPPFRAICQEGKFEYPICE
Download sequence
Identical sequences ENSGGOP00000002394 ENSGGOP00000013103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]