SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013274 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013274
Domain Number 1 Region: 12-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-25
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 205-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000847
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013274   Gene: ENSGGOG00000013610   Transcript: ENSGGOT00000013655
Sequence length 430
Comment pep:novel chromosome:gorGor3.1:7:57153392:57186595:1 gene:ENSGGOG00000013610 transcript:ENSGGOT00000013655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKEMNDGSQMVRSQESLTFQDVAVDFTREEWDQLYPAQKNLYRDVMLENYRNLVALGY
QLCKPEVIAQLELEEEWVIERDSLLDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERL
AGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSLECNKFAENCNLNS
NLMQQRIPPIKIPLNSDTQENSIKHNSDLIYYQGNYVRETPYEYSECGKIFNQHILLTDH
IHTAEKPSECGKAFSHTSSLTQPQMVLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKP
FICNGCGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHHRLHTGEKPYECG
FCGKAFSQRTHLNQHERTHTGEKPYKCNECGKAFSQSAHLNQHRKIHTREKLCDYKCEQT
VRHSPSLSST
Download sequence
Identical sequences ENSGGOP00000013274 XP_018886285.1.27298 ENSGGOP00000013274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]