SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013403 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013403
Domain Number 1 Region: 959-1268
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.31e-92
Family Complement components 0.0000194
Further Details:      
 
Domain Number 2 Region: 1340-1473
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.45e-42
Family Alpha-macroglobulin receptor domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 787-907
Classification Level Classification E-value
Superfamily E set domains 1.08e-34
Family SVA-like 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013403
Domain Number - Region: 368-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0518
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013403   Gene: ENSGGOG00000013727   Transcript: ENSGGOT00000013789
Sequence length 1475
Comment pep:novel chromosome:gorGor3.1:12:9303478:9351584:-1 gene:ENSGGOG00000013727 transcript:ENSGGOT00000013789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV
SASLESVRGNRSLFTDLEAENDVLHCVTFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTV
MVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQS
FQLDGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIIT
ILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCF
YQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFR
QGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGQTQTVQAHY
ILNGGALQGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARL
LIYAVLPTGDVIGDSAKYDVENCLANKVVDLSFSPSQSLPASHAHLRVTAAPQSVCALRA
VDQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVS
STNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQKYEMHGPEGLRVGFYESDVMGRGHAR
LVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLG
ISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIWVSVQLEASPAFLAVPV
EKEQAPHCICANGRQTVSWAITPKSLGNVNFTVSAEALESQELCGTEVASVPEHGKKDTV
IKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAM
QNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYK
HYDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGC
FRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGD
HGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEP
QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALH
ALSKYGAATFTRTGKSAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGE
GCVYLQTSLKYNILPEKEEFPFALGVQTLPQTCVEPKAHTSFQISLSVSYTGSRSASNMA
IVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPV
RDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA
Download sequence
Identical sequences ENSGGOP00000013403 ENSGGOP00000013403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]