SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013435 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013435
Domain Number 1 Region: 21-201
Classification Level Classification E-value
Superfamily HAD-like 1.97e-49
Family NLI interacting factor-like phosphatase 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013435   Gene: ENSGGOG00000013777   Transcript: ENSGGOT00000013823
Sequence length 210
Comment pep:novel chromosome:gorGor3.1:17:7436324:7439857:-1 gene:ENSGGOG00000013777 transcript:ENSGGOT00000013823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFI
LKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKR
RYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTAL
LNLLPMLDALRFTADVRSVLSRNLHQHRLW
Download sequence
Identical sequences ENSGGOP00000013435 ENSGGOP00000013435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]