SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013469 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013469
Domain Number 1 Region: 958-1250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-76
Family Protein kinases, catalytic subunit 0.00000000144
Further Details:      
 
Domain Number 2 Region: 322-484
Classification Level Classification E-value
Superfamily L domain-like 3.97e-44
Family L domain 0.00000244
Further Details:      
 
Domain Number 3 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 1.45e-37
Family L domain 0.00000373
Further Details:      
 
Domain Number 4 Region: 482-602
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-23
Family Fibronectin type III 0.0000349
Further Details:      
 
Domain Number 5 Region: 768-916
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-23
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 6 Region: 606-678,779-801
Classification Level Classification E-value
Superfamily Fibronectin type III 3.84e-17
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 7 Region: 191-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013469   Gene: ENSGGOG00000013800   Transcript: ENSGGOT00000013857
Sequence length 1303
Comment pep:novel chromosome:gorGor3.1:1:135847466:135865437:-1 gene:ENSGGOG00000013800 transcript:ENSGGOT00000013857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLQSLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAVLAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCH
RAAAPGLRLPTSNNDPRFDREDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFE
NFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVL
SGLRHFTEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLL
RWLEPPDPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATS
LAGNGSWTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYA
SVNPEYFSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKT
VNELASPRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSL
RPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDF
GMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQ
GLSNEQVLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELQPSF
RLLSFYYSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH
Download sequence
Identical sequences ENSGGOP00000013469 ENSGGOP00000013469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]