SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013497 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013497
Domain Number 1 Region: 26-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 83-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000839
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 167-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013497
Domain Number - Region: 141-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 219-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00315
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013497   Gene: ENSGGOG00000013834   Transcript: ENSGGOT00000013885
Sequence length 385
Comment pep:novel chromosome:gorGor3.1:2a:109946767:109996192:1 gene:ENSGGOG00000013834 transcript:ENSGGOT00000013885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLILACPEPRASQSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLV
GPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQ
AQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQE
GRPRLCMHACVNTPGSYRCTCPSGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSF
QCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITL
FRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDM
SEYLDRSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences ENSGGOP00000013497 ENSGGOP00000013497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]