SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013503 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013503
Domain Number - Region: 231-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.041
Family Laminin-type module 0.073
Further Details:      
 
Domain Number - Region: 61-170
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0416
Family Growth factor receptor domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013503   Gene: ENSGGOG00000013835   Transcript: ENSGGOT00000013891
Sequence length 1037
Comment pep:novel chromosome:gorGor3.1:1:135900724:135923304:1 gene:ENSGGOG00000013835 transcript:ENSGGOT00000013891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLCPLLLLAVGLRLAGTLNPSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWE
GPHTCPQPTVVYRTVYRQVVKMDHRQRLQCCHGFYESRGFCVPLCAQECVHGRCVAPNQC
QCVPGWRGDDCSSECAPGMWGPQCDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTP
GYYGPACQFRCQCHGAPCDPQTGACFCPAERTGPSCDVSCSQGTSGFFCPSTHPCQNGGV
FQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGRFGQDCTETCDCAPDARCFPANGACLCEHGFTGDRCTDRLCPDGFYGLSCQ
APCTCDREHSLSCHPMNGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQATS
GLCQCAPGYTGPHCASLCPPDTYGVNCSARCSCENAIACSPIDGECVCKEGWQRGNCSVP
CPPGTWGFGCNASCQCAHEAVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASRCDCD
HSDGCDPVHGRCQCQAGWMGARCHLSCPEGLWGVNCSNTCTCKNGGTCLPENGNCVCAPG
FRGPSCQRSCHPGRYGKRCVPCKCANHSFCHPSNGTCYCLAGWTGPDCSQPCPPGHWGEN
CAQTCQCHHGGTCHPQDGSCICPLGWTGHHCLEGCPLGTFGANCSQPCQCGPGEKCHPET
GACVCPPGHSGAPCRIGIQEPFTVMPTTPVAYNSLGAVIGIAVLGSLVVALVALFIGYRH
WQKGKEHHHLAVAYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPNPPPPNKVPG
PLFASLQTPERPGGAQGHDNHTTLPADWKHRREPPPGPLDRGNSRLDRSYSYSYSNGPGP
FFNKGLISEEELGASVASLSSENPYATIRDLPSLPGGPRESSYMEMKGPPSGSPPRQPPQ
FWDSQRRRQPQPQRDSGTYEQPSPLIHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPGHYD
LPPVRHPPSPPLRRQDR
Download sequence
Identical sequences G3RDA5
XP_018880336.1.27298 XP_018880341.1.27298 ENSGGOP00000013503 ENSGGOP00000013503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]