SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013772 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013772
Domain Number 1 Region: 614-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-84
Family Protein kinases, catalytic subunit 0.000000000319
Further Details:      
 
Domain Number 2 Region: 19-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-76
Family Ephrin receptor ligand binding domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-38
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 4 Region: 908-980
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-20
Family SAM (sterile alpha motif) domain 0.00019
Further Details:      
 
Domain Number 5 Region: 252-325,360-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000208
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013772   Gene: ENSGGOG00000014106   Transcript: ENSGGOT00000014166
Sequence length 984
Comment pep:novel chromosome:gorGor3.1:3:134904562:135377810:1 gene:ENSGGOG00000014106 transcript:ENSGGOT00000014166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSMACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQMSQSPTVMA
Download sequence
Identical sequences G3RE07
ENSGGOP00000013772 ENSGGOP00000013772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]