SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013798 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013798
Domain Number 1 Region: 58-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-57
Family G proteins 0.0000000108
Further Details:      
 
Domain Number 2 Region: 352-446
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.53e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000313
Further Details:      
 
Domain Number 3 Region: 255-351
Classification Level Classification E-value
Superfamily Translation proteins 4.52e-28
Family Elongation factors 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013798   Gene: ENSGGOG00000014136   Transcript: ENSGGOT00000014192
Sequence length 455
Comment pep:novel chromosome:gorGor3.1:16:29693690:29697684:-1 gene:ENSGGOG00000014136 transcript:ENSGGOT00000014192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLGRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVV
VYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQ
KLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSK
NIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILE
KGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Download sequence
Identical sequences A0A2I2YVU5
ENSGGOP00000013798 XP_004057461.1.27298 ENSGGOP00000013798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]