SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013865 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013865
Domain Number 1 Region: 304-472
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-58
Family Sec7 domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 515-648
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013865   Gene: ENSGGOG00000014212   Transcript: ENSGGOT00000014265
Sequence length 771
Comment pep:novel chromosome:gorGor3.1:5:123357069:123403875:1 gene:ENSGGOG00000014212 transcript:ENSGGOT00000014265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDKLLSAVPEEGEATRDPGPEPEEEPGVRHGMASEGLNSSLCSPGHERRGTPADTKEP
TKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLCPDAED
PQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPL
TPLIQQRARDSPEPGAGLGIGDMAFEGDMGAAGGDGELGSPLRRSISSSRSENVLSRLSL
MAMPNGFHEDGPQGPGGDEDDDEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGSA
DPLANGCQGVSEAAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLT
LDRALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDESTSEDGIHTLTCALMLLNTDL
HGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSEL
VDDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWK
KFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADW
RVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQL
RSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHYLTFEKSRYETYIHLLAVKIK
VGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHVTGSKTTKDATGPDT
Download sequence
Identical sequences ENSGGOP00000013865 ENSGGOP00000021411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]