SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013958 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013958
Domain Number 1 Region: 37-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-18
Family V set domains (antibody variable domain-like) 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013958   Gene: ENSGGOG00000014312   Transcript: ENSGGOT00000014361
Sequence length 288
Comment pep:novel chromosome:gorGor3.1:2b:131352397:131361558:-1 gene:ENSGGOG00000014312 transcript:ENSGGOT00000014361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSPRPLRPEDGHCSWPL
Download sequence
Identical sequences G3REH1
ENSGGOP00000013958 ENSGGOP00000013958 XP_004033550.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]