SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013959 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013959
Domain Number 1 Region: 461-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 132-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000171
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 9-95
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000128
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 4 Region: 212-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000253
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013959   Gene: ENSGGOG00000014303   Transcript: ENSGGOT00000014362
Sequence length 767
Comment pep:novel chromosome:gorGor3.1:9:66617530:66940231:1 gene:ENSGGOG00000014303 transcript:ENSGGOT00000014362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLS
RKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQI
PNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLR
ITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNP
KPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDE
KQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHL
SVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISNDD
DSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKR
HNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNL
QHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLH
IAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTML
PIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRP
RTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences G3REH2
ENSGGOP00000013959 ENSGGOP00000013959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]