SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013968 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013968
Domain Number 1 Region: 508-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.000000000484
Further Details:      
 
Domain Number 2 Region: 118-310
Classification Level Classification E-value
Superfamily L domain-like 5.95e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 3 Region: 295-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.37e-22
Family Growth factor receptor domain 0.0000026
Further Details:      
 
Domain Number 4 Region: 8-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000124
Family Growth factor receptor domain 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013968   Gene: ENSGGOG00000014309   Transcript: ENSGGOT00000014371
Sequence length 1085
Comment pep:novel chromosome:gorGor3.1:2b:100105976:100456941:-1 gene:ENSGGOG00000014309 transcript:ENSGGOT00000014371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFVCLSYDIDTICVQHCIKYYI
SSLLSFQSHYNNRRGRNVKGFHSNAFPNNFVVDSSSCVRACPSSKMEVEENGIKMCKPCT
DICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPE
KLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQF
QSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLC
SSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLL
TCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNG
PTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALR
RFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIP
VAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEY
VHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARL
LEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTR
EIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVI
QGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQ
FVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVVPHVQEDS
STQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQAL
DNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYW
NHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRH
RNTVV
Download sequence
Identical sequences ENSGGOP00000013968 ENSGGOP00000013968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]