SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013974 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013974
Domain Number 1 Region: 16-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.45e-40
Family Gelsolin-like 0.00000651
Further Details:      
 
Domain Number 2 Region: 377-520
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.08e-39
Family Gelsolin-like 0.0000348
Further Details:      
 
Domain Number 3 Region: 612-731
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.33e-37
Family Gelsolin-like 0.0000224
Further Details:      
 
Domain Number 4 Region: 250-436
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.65e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 5 Region: 513-612
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.27e-26
Family Gelsolin-like 0.00031
Further Details:      
 
Domain Number 6 Region: 752-827
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 9.42e-24
Family VHP, Villin headpiece domain 0.00011
Further Details:      
 
Domain Number 7 Region: 123-233
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-21
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013974   Gene: ENSGGOG00000014322   Transcript: ENSGGOT00000014377
Sequence length 827
Comment pep:novel chromosome:gorGor3.1:2b:107344957:107375994:1 gene:ENSGGOG00000014322 transcript:ENSGGOT00000014377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASNLSY
DIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMKQVETNSYDVQRLLHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGP
ESNRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAV
PDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KKANEQEKKGAMSHALNFIKAKQYPQSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGK
THTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVP
MGKEPPHLMSIFKGRMVVYQGGTSRTNNLEPGPSTRLFQVQGTGTNNTKAFEVPARASFL
NSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGG
KAPYANTKRLQEENLVITPRLFECSNKTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFF
WIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWS
NTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEEL
PEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF
Download sequence
Identical sequences G3REI7
XP_004033253.1.27298 ENSGGOP00000013974 ENSGGOP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]