SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013982 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013982
Domain Number 1 Region: 52-259
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-47
Family Protein kinases, catalytic subunit 0.0000619
Further Details:      
 
Domain Number 2 Region: 524-590
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.01e-18
Family Intermediate filament protein, coiled coil region 0.00075
Further Details:      
 
Domain Number 3 Region: 342-375
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000272
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013982
Domain Number - Region: 379-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00241
Family Intermediate filament protein, coiled coil region 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013982   Gene: ENSGGOG00000014329   Transcript: ENSGGOT00000014385
Sequence length 1649
Comment pep:novel chromosome:gorGor3.1:15:21459398:21625630:-1 gene:ENSGGOG00000014329 transcript:ENSGGOT00000014385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVEKDWGWGLWRNLRCLGHAHQGKCCTEGGISSTTKTSSENGSCCFEKAARKDHVCRF
IGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHR
DIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRN
REMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLD
HISSLDYFTKPDYQMSIRVTQKSYKVSTSGPQAFNSLSYTSGPGACISSSSFSRMGSSSF
RGGLGAGYGGASRGITTVTVNQSLLSPLNLEVDPNIQAVRTQEEKQIKTLNNKFFSFIDK
VRFLEQQNKMHETKWSLVQKQKMAWSNMDNMFESYINNLKWQLETLGQEKLKLEAELGNM
HGLVEDFRNKYEVEISKCTEMENECVLNKEDVDEAYMNKMELESSLKGLTAKISFLRQLY
EEEIGSCSPRSRIHLWCCSWTTAASSTWTASFLRSRPEGFPGGRHADTEQRGELAIKDAN
AKLSELEAALQLASQDMARQLREYQELMNVKLALDIKIAPYRKLLEGEESWLESGMQNMS
IHMKTTSSYAGGQSLAYGDLTSPGLSYGLGSSFGSGMGSSSFSHTSSSRAVVVKKIETRD
GKLVSESSDVLPNLRITATLLTSVFDNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTP
QLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIPVGVSPDKLPGSLGHP
RPQEKDVWEEMDANKNKIKLGIYKAATEEENSHGQANGLLNAPSLGSPIRVRSEITQPDR
DIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSAGKESILPALLHKPCV
PAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNLSSCKQEIDSKEWVIV
DKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQLGPWAENDHLKKETSG
VVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQAEGPLTAITIPRPSVA
STQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGEPPSGGSRTDLGLQID
HIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEKSILLESDNEDEKLSR
GQHCIEISSLPGDLVIVEKVHSATTEPLDVTKTQTFSVVPNQDKNNEITKLLTVGTSEIS
SRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGE
LFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSSPVSAKEKLLQKKAYQ
PDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVLTPFSRLTVDSHLSRS
AEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPGKPPTRPGVEARLRRY
KVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTPPKSPVVPRRSPSASP
RSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQQEHCKPSKNG
LKGSSSLHHHSASTKTPQGKSKPASKLSR
Download sequence
Identical sequences ENSGGOP00000013982 ENSGGOP00000013982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]