SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014013 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014013
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000366
Family Ku80 subunit N-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014013   Gene: ENSGGOG00000014357   Transcript: ENSGGOT00000014416
Sequence length 863
Comment pep:novel chromosome:gorGor3.1:X:133139076:133203549:1 gene:ENSGGOG00000014357 transcript:ENSGGOT00000014416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILLFLIDTSASMNQRTDLGTSYLDIAKGAVELFLKLRARDPASRGDRYMLVTYDEPPY
CIKAGWKENHATFMSELKNLQASGLTTLGQALRSSFDLLNLNRLISGIDNYGQGRNPFFL
EPSILITITDGNKLTSTAGVQEELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGVAS
TEPEQLGSVPTDESAITQMCEVTGGIGRSYCVRTQRMLNQCLESLVQKVQSGVVINFEKT
GPDPLPIGEDGLMDSSRPSNSFAAQPWHSCHKLIYVRPNSKTGVPVGHWPIPESFWPDQN
LPSLPPRTSHPVVRFSCVDCEPMVIDKLPFDKYELEPSPLTQYILERKSPHTCWQVFVTS
SGKYNELGYPFGYLKASTTLTCVNLFVMPYNYPVLLPLLDDLFKVHKLKPNLKWRQAFDS
YLKTLPPYYLLTKLESERILASVGKKPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEIAG
ETALRLTELNTKEFAGFQIGLLNKDLKPQTYRNAYDIPRRGLLDQLTRMRSNLLKTHKFI
VGQDEDSLHSVPVAQMGNYQEYLKTLASPLREIDPDQPKRLHTFGNPFKQDKKGMMIDEA
DEFVAGPQNKVKRPGEPNSPMSSKRRRSMSLLLRKPQTPPTVTNYVGGKGPPSASWFPSY
PNLIKPTLVHTDATVIHDGHEEKMENGQITPDGFLSKSAPSELINMTGDLMPPNQVDSLS
DDFTSLSKDGLIQKPGSNAFVGGAKNCSLSVDDQKDPVASTLGTMPNTLQITPAMAQGIN
ADIKHQLMKEVRKFGRKYERIFILLEEVQGPLEMKKQFVEFTIKEAARFKRRVLIQYLEK
VLEKIDSHHLLNNISHINSRSSC
Download sequence
Identical sequences ENSGGOP00000014013 ENSGGOP00000014013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]