SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014107 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014107
Domain Number 1 Region: 341-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000439
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 277-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 315-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014107
Domain Number - Region: 227-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0516
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014107   Gene: ENSGGOG00000014462   Transcript: ENSGGOT00000014515
Sequence length 618
Comment pep:novel chromosome:gorGor3.1:19:36907674:36916759:1 gene:ENSGGOG00000014462 transcript:ENSGGOT00000014515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPRMSRLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARVPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACARLCRPRSAPSRCGPGLRPCGLLEDECEAPPVCRAGCSPEHGFCEQPGECRCL
QGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECAC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLKPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPRGIYVISAPSIYAREVATPLFSPLHTGRA
GQRQHLVFPYPSSILSVK
Download sequence
Identical sequences ENSGGOP00000014107 ENSGGOP00000014107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]