SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014192 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014192
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000198
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 2 Region: 462-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.0013
Further Details:      
 
Domain Number 3 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014192
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 919-1169
Classification Level Classification E-value
Superfamily Tropomyosin 0.00118
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014192   Gene: ENSGGOG00000014542   Transcript: ENSGGOT00000014602
Sequence length 1193
Comment pep:novel chromosome:gorGor3.1:1:162754857:162813798:1 gene:ENSGGOG00000014542 transcript:ENSGGOT00000014602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNT
DGIHCEKCKNGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGN
PEGCTQCFCYGHSASCRSSAEYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSAQRPDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTFRLNEHASSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGAHCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVECRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGVVPDTELEGRMQQAEQAL
QDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNRVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTR
ETEDYSKQALSLARKALHEEVGSGSGSPEGAVVQGLVGKLEKTKSLAQQLTREATQAEIE
ADRSYQHSLRLLDSVSRLQGVNDQSFQVEEAKRIKQKADSFSSLVTRHMDEFKRTQKNLG
NWKEEAQQLLQNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAGEALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPVSVDEEGLILLEQKLSRAKTQINSQLRP
MMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
Download sequence
Identical sequences G3RF36
ENSGGOP00000014192 XP_004028075.1.27298 ENSGGOP00000014192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]