SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014302 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014302
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-20
Family Intermediate filament protein, coiled coil region 0.00056
Further Details:      
 
Domain Number 2 Region: 106-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000167
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 142-211
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000068
Family Intermediate filament protein, coiled coil region 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014302
Domain Number - Region: 225-329
Classification Level Classification E-value
Superfamily Prefoldin 0.0366
Family Prefoldin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014302   Gene: ENSGGOG00000014663   Transcript: ENSGGOT00000014713
Sequence length 498
Comment pep:novel chromosome:gorGor3.1:9:81432376:81433872:1 gene:ENSGGOG00000014663 transcript:ENSGGOT00000014713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISTPSGISTWLSLPASTPASITSIRVTQKSSGPWAFSSCTYMSGPGVCISSLSCSRVGSS
SFRGGLGGGYGGASGMGGIIAIMVNQSLLSPLNLEVDPNIQAMCTQKKEQIKTLNKFASF
IDKVWFLEQQNKVLETKWSLLQQQKMARSNMDNMLESYINNLRRQLETLGQEKLKLEAEL
GNMQGLGEDFKNKYEDEINKHTEMENEFVLIKKDVDEAYTNQVELESLLEGLTEEINFLR
QLYEEEIRELQSQISDMSVVLSIDYSCSLDMDSIIPEVKVQYEEIANCSRAEAESMYQIK
YEGLQTLAGRNWDDLRRTKTEISEMNRNISWLQAETEGLKGQRASLEAAITDAEQRGELA
VKDANAKPSELEAALQRAKQDMMGQLREYWELMNVGLTLDIEIATYRKLLEGEESRLESG
MQNLSIHTKTTSSYAGGLSSAYGGLTSPGIIYRLGSSFGSGAGSSSFSRTSSTRAVVVKK
IETHDGKLESESSDVLSK
Download sequence
Identical sequences ENSGGOP00000014302 ENSGGOP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]