SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014311 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014311
Domain Number 1 Region: 320-397
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.26e-25
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Domain Number 2 Region: 90-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000628
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 126-197
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000199
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 
Domain Number 4 Region: 214-321
Classification Level Classification E-value
Superfamily Prefoldin 0.0000654
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014311   Gene: ENSGGOG00000014673   Transcript: ENSGGOT00000014722
Sequence length 512
Comment pep:novel chromosome:gorGor3.1:12:50913213:50921114:-1 gene:ENSGGOG00000014673 transcript:ENSGGOT00000014722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSSFRSGLGGGYGGASGM
GGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE
TKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYE
DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL
RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAAL
QRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA
VTLLLESTQINRRAGLTSHPWGCVGSEQGEGAWSLPWGGLLYSCGYLCPSPGGLSSAYGG
LSRTSSSRAVVVKKIETRDGKLVSESSDVLPK
Download sequence
Identical sequences ENSGGOP00000026667 ENSGGOP00000014311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]