SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014339 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014339
Domain Number 1 Region: 224-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-72
Family Protein kinases, catalytic subunit 0.000000107
Further Details:      
 
Domain Number 2 Region: 113-248
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-31
Family SH2 domain 0.00000137
Further Details:      
 
Domain Number 3 Region: 47-136
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000538
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014339   Gene: ENSGGOG00000014700   Transcript: ENSGGOT00000014750
Sequence length 503
Comment pep:novel chromosome:gorGor3.1:19:3860171:3871172:-1 gene:ENSGGOG00000014700 transcript:ENSGGOT00000014750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGHFPAERREGRPRRGTCGQQQLLLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKP
GELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFH
GKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAV
FFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEG
EFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVM
EHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDL
VAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAP
YPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRS
AGAPASVSGQDADGSTSPRSQEP
Download sequence
Identical sequences ENSGGOP00000014339 ENSGGOP00000014339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]