SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014351 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014351
Domain Number 1 Region: 883-1010,1042-1247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-80
Family p120GAP domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 33-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1477-1575
Classification Level Classification E-value
Superfamily RGC domain-like 4.05e-34
Family RGC domain 0.00000979
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014351
Domain Number - Region: 689-750
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.031
Further Details:      
 
Domain Number - Region: 594-626
Classification Level Classification E-value
Superfamily WW domain 0.00325
Family WW domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014351   Gene: ENSGGOG00000014696   Transcript: ENSGGOT00000014762
Sequence length 1575
Comment pep:novel chromosome:gorGor3.1:17:21029990:21341674:-1 gene:ENSGGOG00000014696 transcript:ENSGGOT00000014762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELP
PTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAM
ESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAVEKGIAEQTVVTLRNP
NAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEEERDAYEELLTQAEIQGNINK
VNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFNLQKQNAMNYL
AHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPT
ANISDVDPAHAQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDEANVDEDRAKQWVT
LVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSNDGSW
LKLNLHEKYDYYYNIDSKESSWVTPESCLYKESWLTGKEIEDIIEEVTVGYIRENIWSAS
EELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAFWKGYKQRKEYMHRRQTFIDN
TDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDYKTLVGSENPP
LTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLA
KLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTG
NPTVIKMVVSFNRGARGQNTLRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTG
EASKLPYDVTTEQALTYPEVKNKLEASIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVL
KNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGS
VAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEEKFNMDKYTDL
VTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLT
EILETPATAQQEVDHATDMVSRAMIDSRTPEEMKHSQAMIEDAQLPLEQKKRKIQRNLRT
LEQTGHVSSENKYQDILNEIAKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQIN
YYDTYIKTCLDNLKRKNTRRSIKLDGKGEPKGAKRAKPVKYTAAKLHEKGVLLDIDDLQT
NQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVN
VNLLIYLLNKKFYGK
Download sequence
Identical sequences ENSGGOP00000014351 ENSGGOP00000014351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]