SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014405 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014405
Domain Number 1 Region: 233-371
Classification Level Classification E-value
Superfamily SH2 domain 4.69e-27
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 2 Region: 117-169
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-21
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 199-281
Classification Level Classification E-value
Superfamily SH3-domain 2.4e-20
Family SH3-domain 0.0000285
Further Details:      
 
Domain Number 4 Region: 6-61
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014405   Gene: ENSGGOG00000014764   Transcript: ENSGGOT00000014817
Sequence length 381
Comment pep:novel chromosome:gorGor3.1:2a:103409199:103486641:1 gene:ENSGGOG00000014764 transcript:ENSGGOT00000014817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK
NSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVK
FAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSF
LSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKN
ARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECAL
NERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHY
KKAPIFTSEHGEKLYLVRALQ
Download sequence
Identical sequences ENSGGOP00000014405 ENSGGOP00000014405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]