SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014455 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014455
Domain Number 1 Region: 991-1277
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.23e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000126
Further Details:      
 
Domain Number 2 Region: 343-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000345
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 3 Region: 513-676
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000196
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 4 Region: 92-243
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000799
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 5 Region: 712-843
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000115
Family Fibronectin type III 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014455
Domain Number - Region: 298-337
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00144
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014455   Gene: ENSGGOG00000014808   Transcript: ENSGGOT00000014868
Sequence length 1314
Comment pep:novel chromosome:gorGor3.1:11:48813288:48961801:1 gene:ENSGGOG00000014808 transcript:ENSGGOT00000014868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQILCAGGTPSPIPDPSVATVATGENGITQISSTAESFHKQNGTGTPQVETNTSEDGESS
GASDSLRTPEQGSNGTDGASQKAPSSTDNIGPSPVFDIKAVSISPTNVILTWKSNDTAAS
EYKYVVKNKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRVIKVITEP
IPVSDLRVALTGVRKATLSWSNGNGTASCRVLLESIGSHEELTQDSRLQVNISGLKPGVQ
YNINPYLLQSNKTKGDPLGTEGGLDASNTERSRAGSPTAPVHDESLLGPVDPSSGQQSQD
TEVLLVGLEPGTRYNATVYSQAANGTEGQPQAVEFRTNAIQVFDVTAVNISATSLTLIWK
VSDNESSSNYTYKIHVAGETDSSNFNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGF
LQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAESFQMHITQEGAGNSRVEITTNQSIIIG
GLFPGTKYCFEIVPKGPNGTEGASRTVCNRTAVPSAVFDIHVVYVTTTEMWLEWKSPDGA
SEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGTLYNITISPEVDHVWGDPNSTAQYTHQ
GPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLLIEKVGNSSNATQVVTDIGITDATV
TELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPALVLKWTCPP
GASAGFELEVSSGAWNNATHLESCSSENGTEYRTEVMYLNFSTSYNISITTVSCGKMAAP
TRNTCTTGITVDPPPPDGSPNITSVSHNSVKVKFSGFEASHGPIKAYAVILTTGEAGHPS
ADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSHSLSEVLKYEIDVGNESTTLGYYNGKLE
PLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICGAVFGCIFG
ALVIVTVGGFIFWRKKRKDAKNNEVSFSQRRPKKSKLIRVENFEAYFKKQQADSNCGFAE
EYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY
HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGD
ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVR
DYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQ
TEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
Download sequence
Identical sequences ENSGGOP00000014455 ENSGGOP00000014455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]