SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014497 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014497
Domain Number 1 Region: 14-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-24
Family DEP domain 0.013
Further Details:      
 
Domain Number 2 Region: 219-392
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014497   Gene: ENSGGOG00000014855   Transcript: ENSGGOT00000014910
Sequence length 529
Comment pep:novel chromosome:gorGor3.1:17:36331480:36442732:1 gene:ENSGGOG00000014855 transcript:ENSGGOT00000014910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCS
QNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGQEDFEDNRHLYRFPPSSPLKPYPKKPP
YQKDVIKFPEWNDPPPGTSQENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEA
NVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELP
HWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLG
LLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLMVQTF
SRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKS
YPEVYQERFPTPESEALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
Download sequence
Identical sequences G3RFW5 H2QQY2
ENSGGOP00000014497 ENSGGOP00000014497 XP_003827453.1.60992 XP_018869235.1.27298 9598.ENSPTRP00000028947 ENSPTRP00000028947 ENSPTRP00000028947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]