SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014527 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014527
Domain Number 1 Region: 416-547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000277
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 580-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000357
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 349-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000469
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 95-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000011
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 5 Region: 538-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.026
Further Details:      
 
Domain Number 6 Region: 46-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014527
Domain Number - Region: 317-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 397-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014527   Gene: ENSGGOG00000014886   Transcript: ENSGGOT00000014940
Sequence length 736
Comment pep:novel chromosome:gorGor3.1:2b:118533382:118892048:-1 gene:ENSGGOG00000014886 transcript:ENSGGOT00000014940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDSQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSDGYLC
ICNEGYEGPKCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPK
TGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWK
VTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLV
VKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQNN
ASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEG
YFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCSCSPGFTGPTCAQLIDFCALSPCAHGT
CRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCE
LYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQPN
GYTCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGI
CRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYEDY
SPDDKPLVTLIKTKDL
Download sequence
Identical sequences G3RFZ4
ENSGGOP00000014527 XP_004033357.1.27298 ENSGGOP00000014527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]