SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014812 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014812
Domain Number 1 Region: 39-484
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.93e-98
Family Integrin alpha N-terminal domain 0.000000000696
Further Details:      
 
Domain Number 2 Region: 785-1015
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-66
Family Integrin domains 0.00000498
Further Details:      
 
Domain Number 3 Region: 485-643
Classification Level Classification E-value
Superfamily Integrin domains 3.77e-46
Family Integrin domains 0.0000131
Further Details:      
 
Domain Number 4 Region: 644-778
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-37
Family Integrin domains 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014812   Gene: ENSGGOG00000015171   Transcript: ENSGGOT00000015236
Sequence length 1063
Comment pep:novel chromosome:gorGor3.1:10:15921880:16135602:-1 gene:ENSGGOG00000015171 transcript:ENSGGOT00000015236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGASRGPRGSQAPLIAPLCCAAAALGMMLWTPACQAFNLDVEKLTVYSGPKGSYFGYA
VDFHVPDASTASVLVGAPKANTSQPDIMEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDVAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAIPSGFGFTLRGDSDIDRNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHRIFPLVIKRQKSHQCQNFIVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLGVKPVLNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTNPNINPQDIKPAASPEDTPELSAFLQNSTIP
HLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGQLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTPEA
Download sequence
Identical sequences A0A2I2YGH9
ENSGGOP00000014812 XP_004049142.1.27298 ENSGGOP00000014812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]