SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014879 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014879
Domain Number 1 Region: 610-887
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-79
Family Protein kinases, catalytic subunit 0.000000000646
Further Details:      
 
Domain Number 2 Region: 17-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-64
Family Ephrin receptor ligand binding domain 0.0000000079
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-33
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 906-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 250-320,361-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000471
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014879   Gene: ENSGGOG00000015248   Transcript: ENSGGOT00000015303
Sequence length 988
Comment pep:novel chromosome:gorGor3.1:7:98318130:98345436:-1 gene:ENSGGOG00000015248 transcript:ENSGGOT00000015303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRALLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTMGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPI
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDAESEGWREQLA
LIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDP
NEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRR
EFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVG
MLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLG
GKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRL
PPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLL
DQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQK
KILASVQHMKSQAKPGTPGGTGGPAPQY
Download sequence
Identical sequences ENSGGOP00000014879 ENSGGOP00000014879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]