SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014899 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014899
Domain Number 1 Region: 203-346
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-44
Family Dual specificity phosphatase-like 0.00000101
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-19
Family Cell cycle control phosphatase, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014899   Gene: ENSGGOG00000015273   Transcript: ENSGGOT00000015324
Sequence length 384
Comment pep:novel chromosome:gorGor3.1:X:151620914:151624306:1 gene:ENSGGOG00000015273 transcript:ENSGGOT00000015324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
YYLQGGFSRFQAECPHLCETSLGGRAGSSMAPVPSPVPVVGLGSLCLGSDCSDAESEADR
DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
PNFFEKNGDFHYKQIPISDHWSQNLSQFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
SAASNPPSFFTTPTSDGAFELAPT
Download sequence
Identical sequences G3RGY6
ENSGGOP00000014899 XP_003804893.1.60992 XP_008962495.1.60992 XP_018874348.1.27298 ENSGGOP00000014899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]