SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014904 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000014904
Domain Number - Region: 70-148
Classification Level Classification E-value
Superfamily Prefoldin 0.00262
Family Prefoldin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014904   Gene: ENSGGOG00000015278   Transcript: ENSGGOT00000015329
Sequence length 221
Comment pep:novel chromosome:gorGor3.1:19:17738986:17752523:-1 gene:ENSGGOG00000015278 transcript:ENSGGOT00000015329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTLYDYCRVPMDAILKKDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRD
GLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEE
LEGEITTLNHKLQDASAEVERLRRENQVLSVRIADTKYYPSSHFPSTPQSRLQTQLTALK
IEMDEAKAQGTQMGAENGALTGALGCKGVGRDRSGRSLGES
Download sequence
Identical sequences ENSGGOP00000014904 ENSGGOP00000014904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]