SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014969 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014969
Domain Number 1 Region: 7-187
Classification Level Classification E-value
Superfamily HAD-like 5.15e-49
Family Phosphoserine phosphatase 0.0000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014969   Gene: ENSGGOG00000015343   Transcript: ENSGGOT00000015397
Sequence length 190
Comment pep:novel chromosome:gorGor3.1:7:57263742:57286702:-1 gene:ENSGGOG00000015343 transcript:ENSGGOT00000015397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSHSELRKVFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKA
ALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
SKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDG
ATDMEACPPA
Download sequence
Identical sequences ENSGGOP00000014969 ENSGGOP00000014969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]