SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015022 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015022
Domain Number 1 Region: 31-382
Classification Level Classification E-value
Superfamily L domain-like 1.16e-62
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 327-492
Classification Level Classification E-value
Superfamily L domain-like 1.39e-26
Family Leucine rich effector protein YopM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015022   Gene: ENSGGOG00000015396   Transcript: ENSGGOT00000015452
Sequence length 563
Comment pep:novel chromosome:gorGor3.1:3:170768062:170783500:1 gene:ENSGGOG00000015396 transcript:ENSGGOT00000015452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTIMSKDIKSVEHSPKIHQRNDPQHVNDRTFFIDASNQSLTAIPLEIFTFTELEEVHLEN
NQIEEIPQEIQRLKNIRVLYLDKNNLRSLCPALGLLSSLESLDLSYNPIFSSSLVVVSFL
HALRELRLYQTDLKEIPVVICKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQF
EVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFHMASNNLPVLPASLCQCSQLS
VLDLSHNLLHSIPKSLAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGLHRLPG
SFRCLINLRFLDLSQNHLDHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSKLKILGLT
GNEFLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSL
GSMPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDN
PMEEPPKEVCAEGNEAIWKYLKENRNRNIMATKIQAWWRGTMVQRGFGKFGELLKPQKKG
KTSPKDKKGKKGVKGKPGKGKKK
Download sequence
Identical sequences ENSGGOP00000015022 ENSGGOP00000015022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]