SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015038 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015038
Domain Number 1 Region: 23-142,334-646
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.62e-69
Family Integrin alpha N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 162-356
Classification Level Classification E-value
Superfamily vWA-like 4.9e-45
Family Integrin A (or I) domain 0.0000043
Further Details:      
 
Domain Number 3 Region: 646-793
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-26
Family Integrin domains 0.0016
Further Details:      
 
Domain Number 4 Region: 794-931
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-22
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 5 Region: 966-1095
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000288
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015038   Gene: ENSGGOG00000015407   Transcript: ENSGGOT00000015468
Sequence length 1169
Comment pep:novel chromosome:gorGor3.1:1:125205502:125223323:1 gene:ENSGGOG00000015407 transcript:ENSGGOT00000015468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEDQ
GSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALED
EFPPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQ
GEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGT
LQPEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQR
IAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQA
ISVVQRDCRRRGQEAVCLTAALCFRVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGS
GQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTS
IQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAY
NTSLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVAFLLEFEF
SCSSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYG
TLPVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQN
LTEPPGPPVHPEELQHINRLNGSNTQCQVVRCHLGQLAKGTKVSVGLLRLVHNEFFQRAK
FKSLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLA
LLVFCLWKLGFFAHKKIPEEEKREEKLEQ
Download sequence
Identical sequences ENSGGOP00000015038 ENSGGOP00000015038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]