SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015042 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015042
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily L domain-like 8.5e-29
Family U2A'-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015042   Gene: ENSGGOG00000015417   Transcript: ENSGGOT00000015472
Sequence length 249
Comment pep:novel chromosome:gorGor3.1:15:48132872:48176263:-1 gene:ENSGGOG00000015417 transcript:ENSGGOT00000015472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEEEEELGEEERGQKRKRE
PEDEGEDDD
Download sequence
Identical sequences G3RHC4
ENSGGOP00000015042 XP_004056444.1.27298 ENSGGOP00000015042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]