SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015068 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015068
Domain Number 1 Region: 86-233
Classification Level Classification E-value
Superfamily L domain-like 6.8e-28
Family Internalin LRR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015068   Gene: ENSGGOG00000015445   Transcript: ENSGGOT00000015499
Sequence length 542
Comment pep:novel chromosome:gorGor3.1:11:455602:474309:1 gene:ENSGGOG00000015445 transcript:ENSGGOT00000015499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGWDRSRGPRPSTSSVRVRELSWQGLHNPCPQSKGPGSQRDSLGEQLVEEYLSPARLQ
ALARVDDLRLVRALEMCVDTREGSLRNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQV
LWLAHCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRY
LQLCPRLVMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPP
APLRLSQDWFAVKEAIKKGNGLPPLDCPRGAPIWRLDPELSLPETQPRASRPWPFSLLVH
GGPLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPG
DPAASTSTPEPDPTDSSDFLALAGLRAWRERGVRPLPCRHPESQQEGAVAPWGPRRVPEE
QVHQAEPKTPSSPPSLASESSGTSSQHLVPSPPKHPRPRDSGSNSLRWSTDLQSRGRRLR
ALGSWGPGLGDGVAAVPVLRALEVASGLSPRAQGRPGPKPAPDAAARPPRAAELSHPSPI
PT
Download sequence
Identical sequences G3RHE9
XP_018891924.1.27298 XP_018891925.1.27298 XP_018891926.1.27298 ENSGGOP00000015068 ENSGGOP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]