SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015141 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015141
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.93e-22
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 94-173
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000806
Family Ubiquitin-related 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015141   Gene: ENSGGOG00000015521   Transcript: ENSGGOT00000015576
Sequence length 345
Comment pep:novel chromosome:gorGor3.1:20:56367522:56377725:-1 gene:ENSGGOG00000015521 transcript:ENSGGOT00000015576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGRGWAMRRAAAGARGARAAGPTGGASRLHPNAGRRSGARAGAQGRGGPRAGSXXXXX
XXXXPPACARGRSQRLVGDPKAASALPDLAPDVFVLRVRLEETGEMFRVANCRGDMTVRE
LKEELDLMVGIPFNLQRLQYLDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAA
VEGDPSKLSCLGLTEDSFYRTANSEHFEGEKWKQWTSQRAFVALYVASHRGHFDAVQYLL
EQGASCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGASIHDRDAKGETPISIAHRLNHTL
SERQMVLLHRIAKSGIRDLNDLVMKNALQRVKSGFRSEKMMMTPH
Download sequence
Identical sequences G3RHL9
XP_004062517.2.27298 ENSGGOP00000015141 ENSGGOP00000015141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]