SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015162 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015162
Domain Number 1 Region: 402-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 275-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000581
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 235-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000117
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 197-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 486-521,578-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000013
Family Growth factor receptor domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015162
Domain Number - Region: 1111-1146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 886-1015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number - Region: 1546-1575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.069
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 644-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015162   Gene: ENSGGOG00000015536   Transcript: ENSGGOT00000015597
Sequence length 1636
Comment pep:novel chromosome:gorGor3.1:1:3585206:3709287:-1 gene:ENSGGOG00000015536 transcript:ENSGGOT00000015597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGWTRRSGLRGATLGAGGKPGRSAPAATLGSADQARAPVAASYGARGGGGSGEPPGPPVS
RGAEEAPARTMSFLEEARAAGRAVVLALVLLLLPAVPVGASVPPRPLLPLQPSMSHVCAE
QELTLVGRRQPCVQAFSHTVPVWKAGCGWQAWCVGHERRTVYYMGYRQVYTTEARTVLRC
CRGWTQQPGEEGCLSAECSAGLCFHGGRCVPGSAQPCHCPPGFQGPRCQYDVDECRTHNG
GCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCR
PGFQLQEDGRRCVRRSPCANRNGGCMHRCQVVRGLAHCECHVGYQLAADGKACEDVDECA
AGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTS
AGPLCTCPRGYELDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECSCYAGYRLSADGCGC
EDVDECTSSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPVVDLDGELPFVRP
LPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNG
GTCLPGLDGCDCPEGWTGLICNETCPPDTFGKNCTFSCSCQNGGTCDSVTGACRCPPGVS
GTNCEDGCPKGYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGC
SEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECEPGYFGPGCRQACTCPVGVACDSV
SGECGKRCPAGFQGEDCGQECPVGTFGVNCSGSCSCGGAPCHGVTGQCRCPPGRTGEDCE
ADCPEGRWGLGCQEICPACQHAARCDPESGACLCLPGFVGSRCQDVCPAGWYGPSCQTRC
SCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSQPCNCSAGHGSCDAISGLCL
CEAGYVGPRCEQKCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAG
FFGLDCRSACNCTSGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGAS
CDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGL
ACEKECLPGDVGAGCRHSCGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQ
RCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCARMCRCPGENPACHPATGT
CSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPAGFLGADCNLTCP
QGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGXXXPRGCPQNRFGVGCEHTCSCRNG
GLCHASNGSCSCGLGWMGRHCELACPPGRYGAACRLECSCHNNSTCEPATGTCRCGPGFY
GQACEHPCPPGFHGAGCQGVCQCQHGAPCDPISGRCLCPAGLHGHFCERGCEPGSFGEGC
HQRCDCDGGAPCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSG
QCHCVDGYMGPTCREGGPLRLPENPSLAQGSASGHTARLQQTHILERWTSKALVEAVPWS
PPLQSQPEGTQAFGDH
Download sequence
Identical sequences ENSGGOP00000015162 ENSGGOP00000015162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]